![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010938445.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 174aa MW: 19395.3 Da PI: 4.9586 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.4 | 6.4e-56 | 29 | 124 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal+tlGf+dyvep++ yl+kyre+eg+ XP_010938445.1 29 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALSTLGFDDYVEPMRRYLQKYREMEGD 123 89********************************************************************************************9 PP NF-YB 97 k 97 + XP_010938445.1 124 R 124 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.7E-55 | 22 | 147 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.09E-41 | 31 | 146 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.3E-28 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.4E-20 | 62 | 80 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.4E-20 | 81 | 99 | No hit | No description |
PRINTS | PR00615 | 2.4E-20 | 100 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MADGMGSSSD LEGHQNNSYT AQGDQEGIKE QDRLLPIANV GRIMKQILPP NAKISKEAKE 60 TMQECVSEFI SFVTGEASDK CHKEKRKTVN GDDICWALST LGFDDYVEPM RRYLQKYREM 120 EGDRSASGSH GGRVNSSDSR DEERGEQHGD PSSVAGQFMF NAMERSDAST SRRF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-44 | 28 | 119 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-44 | 28 | 119 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010938445.1 | 1e-129 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | O82248 | 2e-58 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2H3XXC4 | 1e-107 | A0A2H3XXC4_PHODC; nuclear transcription factor Y subunit B-1 | ||||
STRING | XP_008789950.1 | 1e-107 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-60 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|