PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis

Family

bZIP

Protein Properties

Length: 160aa MW: 17875.3 Da PI: 7.4541

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010936666.1	genome	OG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	40.7	5e-13	30	82	5	57
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 ++++r+ +NRe+ArrsR RK++ ++ L v L +eN++ l+ ++++ XP_010936666.1 30 RKQKRMLSNRESARRSRMRKQKHLDDLMAQVGHLRKENSQILTALNITTQHYL 82 79*************************************99887777666665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.1E-17	26	90	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.772	28	91	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	4.6E-10	28	105	No hit	No description
Pfam	PF00170	2.3E-10	30	74	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	9.38E-13	30	81	No hit	No description
CDD	cd14702	1.43E-20	31	81	No hit	No description
PROSITE pattern	PS00036	0	33	48	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009845	Biological Process	seed germination
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MASSSGTSSA SSQLPNSGSE DDLQALMHQR KQKRMLSNRE SARRSRMRKQ KHLDDLMAQV 60 GHLRKENSQI LTALNITTQH YLGVEAENSV LRTQMMELNT RLQSLDEILC YMNGGGSNDF 120 GFGVVSNGLE ATDDCFMRPW SLMAMNCQPI MASAGMFQYC

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	42	49	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269\|PubMed:23461773}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00239	DAP	Transfer from AT1G75390	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010936666.1	1e-117	bZIP transcription factor 11
Swissprot	C0Z2L5	7e-46	BZP44_ARATH; bZIP transcription factor 44
TrEMBL	A0A2H3XK43	6e-84	A0A2H3XK43_PHODC; bZIP transcription factor 11-like
STRING	XP_008784951.1	1e-84	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4459	33	67

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75390.1	6e-47	basic leucine-zipper 44

Publications ? help Back to Top
Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]