 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
XP_010913307.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
Family |
NF-YB |
Protein Properties |
Length: 122aa MW: 13402.1 Da PI: 4.7941 |
Description |
NF-YB family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
XP_010913307.1 | genome | OG | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NF-YB | 178.7 | 5.4e-56 | 26 | 119 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+eqdrflPian++rim+k++P+n+ki+kdake+vqecvsefisfvtseasdkcqrekrktingddllwa++tlGfedyveplk+yl+ yre+e
XP_010913307.1 26 KEQDRFLPIANIGRIMRKAIPENGKIAKDAKESVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMGTLGFEDYVEPLKLYLQLYREMEY 119
89******************************************************************************************95 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0005634 | Cellular Component | nucleus |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0046982 | Molecular Function | protein heterodimerization activity |
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1n1j_A | 1e-48 | 26 | 116 | 3 | 93 | NF-YB |
4awl_B | 1e-48 | 26 | 116 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-48 | 26 | 116 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |