![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010554998.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 132aa MW: 15477 Da PI: 10.6446 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 98.9 | 3.6e-31 | 63 | 116 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl XP_010554998.1 63 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVEGLTRENVASHLQKYRL 116 59*******************.********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.16E-20 | 60 | 120 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 9.748 | 60 | 119 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-31 | 62 | 121 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.5E-25 | 64 | 116 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.5E-8 | 66 | 115 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MREDNPNWLA RWEEELPPPE DLIPLSQTLI SPPLALAFHI DKFPPPPTDY AGDLTEPART 60 LKRPRLVWTP QLHKRFVDAV AHLGIKNAVP KTIMQLMSVE GLTRENVASH LQKYRLYLRR 120 IERVRRSISW RR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 6e-34 | 63 | 119 | 1 | 57 | Transcription factor LUX |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 114 | 123 | RLYLRRIERV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010554998.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010554998.1 | 7e-92 | PREDICTED: transcription factor PCL1 | ||||
Swissprot | O22210 | 1e-49 | MYBC1_ARATH; Transcription factor MYBC1 | ||||
TrEMBL | A0A0D3CLC9 | 7e-56 | A0A0D3CLC9_BRAOL; Uncharacterized protein | ||||
STRING | XP_010554998.1 | 3e-91 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1549 | 27 | 91 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G05090.1 | 6e-44 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|