PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010538453.1

Organism

Tarenaya hassleriana

Taxonomic ID

28532

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

NF-YB

Protein Properties

Length: 174aa MW: 19392.4 Da PI: 6.917

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010538453.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	185.9	3.1e-58	21	116	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqdrflPianvsrimkk+lPanakisk+aket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyv+plkvyl+++re+ege XP_010538453.1 21 REQDRFLPIANVSRIMKKALPANAKISKEAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVDPLKVYLQRFREMEGE 115 89********************************************************************************************9 PP NF-YB 97 k 97 + XP_010538453.1 116 R 116 7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	5.1E-54	14	118	IPR009072	Histone-fold
SuperFamily	SSF47113	1.71E-41	23	131	IPR009072	Histone-fold
Pfam	PF00808	1.6E-28	26	90	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	3.1E-20	54	72	No hit	No description
PROSITE pattern	PS00685	0	57	73	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	3.1E-20	73	91	No hit	No description
PRINTS	PR00615	3.1E-20	92	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 174 aa Download sequence Send to blast
MADSDKDSGG GSNNGNRQSP REQDRFLPIA NVSRIMKKAL PANAKISKEA KETMQECVSE 60 FISFVTGEAS DKCQKEKRKT INGDDLLWAM TTLGFEDYVD PLKVYLQRFR EMEGERTGLS 120 RPYSAAGDDA PLADTPNSGV GFYDGGGNMH HHRHHHHHHH QPHNMYRGEG GPSN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-48	21	111	2	92	Transcription factor HapC (Eurofung)
4g92_B	2e-48	21	111	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010538453.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT031158	6e-80	KT031158.1 Glycine max clone HN_CCL_197 CCAAT transcription factor (Glyma15g12570.1) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010538453.1	1e-130	PREDICTED: nuclear transcription factor Y subunit B-2
Swissprot	Q9FGJ3	1e-70	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBL	A0A398AL77	4e-75	A0A398AL77_BRACM; Uncharacterized protein
STRING	XP_010538453.1	1e-129	(Tarenaya hassleriana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47640.1	1e-71	nuclear factor Y, subunit B2

Publications ? help Back to Top
Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]