PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

YABBY

Protein Properties

Length: 220aa MW: 24353.5 Da PI: 8.8431

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010533768.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	203.2	1e-62	14	176	5	170
YABBY 5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 e++Cyv+Cn C+t+lavsvPstsl+k+vtvrCGhCt+ll v++ l ++ + +s+ +++ + + ++ +++ + +++ ++ +s XP_010533768.1 14 PLHEHLCYVHCNICDTVLAVSVPSTSLSKTVTVRCGHCTTLLPVHMPL---LFPSLGQ-FHSFVHNQNPTGEIQNPSTNHTINESSGNHLFATSP 104 5689*************************************87655...5566665.356666666677777777777776666666777777 PP YABBY 100 klsenedeevprvpp.virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 ++ ++e+pr ++ + rP krqrvPsaynrfikeeiqrika+nP+i+hreafsaaaknWahfP+i fgl XP_010533768.1 105 PCPRGMTKELPRSHQvIKRPQAKRQRVPSAYNRFIKEEIQRIKAENPNITHREAFSAAAKNWAHFPHIQFGL 176 889********4557889**********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.9E-63	16	176	IPR006780	YABBY protein
SuperFamily	SSF47095	6.94E-9	114	170	IPR009071	High mobility group box domain
CDD	cd00084	3.38E-6	121	166	No hit	No description
Gene3D	G3DSA:1.10.30.10	8.1E-5	127	170	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 220 aa Download sequence Send to blast
MSSSSSSSSS SDQPLHEHLC YVHCNICDTV LAVSVPSTSL SKTVTVRCGH CTTLLPVHMP 60 LLFPSLGQFH SFVHNQNPTG EIQNPSTNHT INESSGNHLF ATSPPCPRGM TKELPRSHQV 120 IKRPQAKRQR VPSAYNRFIK EEIQRIKAEN PNITHREAFS AAAKNWAHFP HIQFGLAPDQ 180 LARRSSIRHQ EGEDPVMKDV LLASANVGMA PAINYSITYN

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010533768.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010533768.1	1e-164	PREDICTED: axial regulator YABBY 5-like
Swissprot	O22152	6e-56	YAB1_ARATH; Axial regulator YABBY 1
TrEMBL	A0A0D2T6N1	5e-83	A0A0D2T6N1_GOSRA; Uncharacterized protein
TrEMBL	A0A2P5R6J2	5e-83	A0A2P5R6J2_GOSBA; Uncharacterized protein
STRING	XP_010533768.1	1e-163	(Tarenaya hassleriana)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	7e-58	YABBY family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]