PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

HD-ZIP

Protein Properties

Length: 269aa MW: 29833.3 Da PI: 8.5075

Description

HD-ZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010531658.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	56.4	5.1e-18	136	190	2	56
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ +++k q +Lee F+ +++++ +++ LAk+lgL rqV vWFqNrRa+ k XP_010531658.1 136 RKKLRLSKGQSAVLEETFKDHNTLNPRQKLALAKQLGLRPRQVEVWFQNRRARTK 190 7788999**********************************************98 PP
2	HD-ZIP_I/II	126.3	1.3e-40	136	226	1	92
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 +kk+rlsk q+++LEe+F+ +++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+ke +eLr +lk XP_010531658.1 136 RKKLRLSKGQSAVLEETFKDHNTLNPRQKLALAKQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLRRCCENLTEENRRLQKEAAELR-ALK 226 69*************************************************************************************9.555 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04618	1.1E-32	2	109	IPR006712	HD-ZIP protein, N-terminal
Gene3D	G3DSA:1.10.10.60	1.7E-17	108	193	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.21E-18	117	193	IPR009057	Homeodomain-like
PROSITE profile	PS50071	16.925	132	192	IPR001356	Homeobox domain
SMART	SM00389	2.2E-15	134	196	IPR001356	Homeobox domain
Pfam	PF00046	1.8E-15	136	190	IPR001356	Homeobox domain
CDD	cd00086	8.10E-15	136	193	No hit	No description
PRINTS	PR00031	1.7E-5	163	172	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	167	190	IPR017970	Homeobox, conserved site
PRINTS	PR00031	1.7E-5	172	188	IPR000047	Helix-turn-helix motif
Pfam	PF02183	3.7E-10	192	226	IPR003106	Leucine zipper, homeobox-associated
SMART	SM00340	3.3E-24	192	235	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 269 aa Download sequence Send to blast
MMVEKDDLGL SLSLGFPQNQ TNPKLNPSPS VSSPSSPFGF LGKSSWNGSF NSSAPNSEPF 60 RVRTRTFIRS IDVNRAPSTS EAAECDDEAG VSSPNSTVSS ASGKRSERET NGSEDHDTDP 120 PCSRGISDEE DGDTSRKKLR LSKGQSAVLE ETFKDHNTLN PRQKLALAKQ LGLRPRQVEV 180 WFQNRRARTK LKQTEVDCEF LRRCCENLTE ENRRLQKEAA ELRALKTSPH LCMHMPPPTT 240 LTLCPSCHRL SSAVNSPWCP GAPISHRLR

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	134	140	SRKKLRL
2	184	192	RRARTKLKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269\|PubMed:10477292, ECO:0000269\|PubMed:11260495, ECO:0000269\|PubMed:8449400}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010531658.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269\|PubMed:8106086}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010531658.1	0.0	PREDICTED: homeobox-leucine zipper protein HAT4
Swissprot	Q05466	1e-114	HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBL	A0A2N9F0H6	1e-122	A0A2N9F0H6_FAGSY; Uncharacterized protein
STRING	XP_010531658.1	0.0	(Tarenaya hassleriana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1563	26	90

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16780.1	2e-93	homeobox protein 2

Publications ? help Back to Top
Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development. Plant Signal Behav, 2014. [PMID:23838958] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Francisco M, et al. Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense. Front Plant Sci, 2016. 7: p. 1010 [PMID:27462337] Müller-Moulé P, et al. YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance. PeerJ, 2016. 4: p. e2574 [PMID:27761349] Ivarson E, et al. Effects of Overexpression of WRI1 and Hemoglobin Genes on the Seed Oil Content of Lepidium campestre. Front Plant Sci, 2016. 7: p. 2032 [PMID:28119714] Kasulin L, et al. A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina. Mol. Ecol., 2017. 26(13): p. 3389-3404 [PMID:28316114] Singh M,Gupta A,Singh D,Khurana JP,Laxmi A Arabidopsis RSS1 Mediates Cross-Talk Between Glucose and Light Signaling During Hypocotyl Elongation Growth. Sci Rep, 2017. 7(1): p. 16101 [PMID:29170398]