![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010523708.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 254aa MW: 29226.2 Da PI: 8.9349 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.2 | 3.5e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdae+a+iifs++gklye+ XP_010523708.1 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEIALIIFSTRGKLYEFG 58 79**********************************************95 PP | |||||||
2 | K-box | 85.4 | 1.2e-28 | 76 | 176 | 4 | 99 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk......ekelqeenk 92 s+++ e++++s++qe++kLk+++e+L r+qRhllGedL++++++eLq Le+qLe +l+ R++K+++++e++eel+kk e++l ++nk XP_010523708.1 76 SQDN-RVERETQSWYQEVTKLKAKYESLLRTQRHLLGEDLGQMNVRELQTLEKQLEVALSMTRQRKTQVMMEHMEELRKKsslewqERQLGDINK 169 4455.456779********************************************************************9665555678888888 PP K-box 93 aLrkkle 99 +Lr kle XP_010523708.1 170 QLRIKLE 176 8888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.4E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.165 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.54E-43 | 2 | 70 | No hit | No description |
SuperFamily | SSF55455 | 3.4E-32 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.9E-25 | 82 | 175 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.048 | 85 | 181 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010094 | Biological Process | specification of carpel identity | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048455 | Biological Process | stamen formation | ||||
GO:0048459 | Biological Process | floral whorl structural organization | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0080112 | Biological Process | seed growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 254 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEIALIIFST RGKLYEFGSV 60 GIGKTIERYQ RSYSCSQDNR VERETQSWYQ EVTKLKAKYE SLLRTQRHLL GEDLGQMNVR 120 ELQTLEKQLE VALSMTRQRK TQVMMEHMEE LRKKSSLEWQ ERQLGDINKQ LRIKLEAEGH 180 CFNAIQDLWA NSAAAVAGPS TSSFHLQSSH PNSMDCDTEP FLQIGFQQHY VQGEGSSVTK 240 SAACETNFVQ GWVL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 7e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 7e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 7e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 7e-21 | 1 | 69 | 1 | 69 | MEF2C |
6byy_A | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 8e-21 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6bz1_B | 8e-21 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6bz1_C | 8e-21 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
6bz1_D | 8e-21 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00315 | DAP | Transfer from AT2G45650 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010523708.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010523708.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL6 isoform X1 | ||||
Swissprot | P29386 | 1e-140 | AGL6_ARATH; Agamous-like MADS-box protein AGL6 | ||||
TrEMBL | A0A087H5F2 | 1e-137 | A0A087H5F2_ARAAL; Uncharacterized protein | ||||
STRING | XP_010523708.1 | 0.0 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4302 | 26 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 1e-142 | AGAMOUS-like 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|