PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010523346.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 230aa MW: 25843.4 Da PI: 9.6021 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.5 | 8.7e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr gi+KKAeELSvLCdaeva+iifs tgkl+e+ss XP_010523346.1 9 KKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 58.9 | 2.2e-20 | 87 | 171 | 15 | 99 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + + +la+L k ie r++R+l GedL+ Lsl +Lq+Le+ +e++l ++R+kK e ++ +i+ l ++ el+een++Lr++l+ XP_010523346.1 87 QPENSNLARLSKDIEDKTRQLRQLRGEDLQGLSLDDLQRLEKLVESGLGRVREKKGERVMGEISSLERRGAELEEENNNLRQRLM 171 55577899**************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.9E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.997 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.36E-38 | 2 | 69 | No hit | No description |
SuperFamily | SSF55455 | 3.92E-30 | 3 | 71 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 14.057 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.5E-17 | 90 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MAREKIRIKK IDNVTARQVT FSKRRRGIFK KAEELSVLCD AEVALIIFSA TGKLFEFSSS 60 RMRDILARYN LHASNLNKLN PPLALQQPEN SNLARLSKDI EDKTRQLRQL RGEDLQGLSL 120 DDLQRLEKLV ESGLGRVREK KGERVMGEIS SLERRGAELE EENNNLRQRL MMLERGKTAA 180 FREGETVAGV QEGMSLESAV TTNVSSSSSA SPLDDDFSDT SLKLALPFSM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010523346.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010523346.1 | 1e-164 | PREDICTED: MADS-box protein AGL24 isoform X1 | ||||
Refseq | XP_010523347.1 | 1e-164 | PREDICTED: MADS-box protein AGL24 isoform X1 | ||||
Swissprot | O82794 | 1e-102 | AGL24_ARATH; MADS-box protein AGL24 | ||||
TrEMBL | V4LW03 | 1e-109 | V4LW03_EUTSA; Uncharacterized protein | ||||
STRING | XP_010523346.1 | 1e-164 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4190 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24540.1 | 6e-84 | AGAMOUS-like 24 |