![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010520827.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 238aa MW: 27034.9 Da PI: 9.6542 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.1 | 4.1e-27 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRr g+lKKA+EL +LCdaev +i+fsstgkly++ss XP_010520827.1 10 RIDNSTSRQVTFSKRRSGLLKKAKELAILCDAEVGIIVFSSTGKLYDFSS 59 8***********************************************96 PP | |||||||
2 | K-box | 87.8 | 2.2e-29 | 78 | 168 | 8 | 98 |
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 s + ++ + +q+e+a L+++++nLq+++R+++Ge+L+ Ls+k+Lq+Le+qLe sl+ +R kK+++l+++ieel +ke+ +++en +L+k+l XP_010520827.1 78 SDTVSEIKFWQREAAILRQQLHNLQENHRKMMGEELSGLSIKDLQSLESQLELSLRGVRMKKDQILMDEIEELNRKENLMHQENLELHKEL 168 35677899********************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.525 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.03E-43 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 1.7E-31 | 2 | 82 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.2E-27 | 82 | 168 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.083 | 84 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010440 | Biological Process | stomatal lineage progression | ||||
GO:0048574 | Biological Process | long-day photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRSGLLK KAKELAILCD AEVGIIVFSS TGKLYDFSSS 60 SMKSIIERYG DTKGDSESDT VSEIKFWQRE AAILRQQLHN LQENHRKMMG EELSGLSIKD 120 LQSLESQLEL SLRGVRMKKD QILMDEIEEL NRKENLMHQE NLELHKELNL MRRENKELQK 180 KVSVLGGSDS AKRNSLLTNG LDIRDDSTEP VHLHLSLPRH VQAPAAGATK PGYFSFIT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-21 | 1 | 84 | 1 | 84 | MEF2C |
5f28_B | 4e-21 | 1 | 84 | 1 | 84 | MEF2C |
5f28_C | 4e-21 | 1 | 84 | 1 | 84 | MEF2C |
5f28_D | 4e-21 | 1 | 84 | 1 | 84 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00410 | DAP | Transfer from AT3G57230 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010520827.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010520827.1 | 1e-174 | PREDICTED: agamous-like MADS-box protein AGL16 | ||||
Swissprot | A2RVQ5 | 1e-121 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
TrEMBL | A0A1J3G579 | 1e-121 | A0A1J3G579_NOCCA; Agamous-like MADS-box protein AGL16 | ||||
STRING | XP_010520827.1 | 1e-173 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM530 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 1e-115 | AGAMOUS-like 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|