![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010519728.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 203aa MW: 22709.8 Da PI: 6.9028 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 72.7 | 3e-23 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienks rqvtfskRr g+ KA LSvLCda vav+++ss++kly +ss XP_010519728.1 9 KRIENKSSRQVTFSKRRGGLVEKARQLSVLCDAAVAVLVVSSSDKLYSFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 32.1 | 4.9e-12 | 97 | 165 | 30 | 98 |
K-box 30 nLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 L++ +l+ +L++ s+ +q+e qLe +l+ R+kK++ll+e+++ l++ke++l+ee + L +++ XP_010519728.1 97 LLETLESRLKEPNLGNVSIDSVNQMEWQLEGALSAARAKKTQLLMESLKALKEKENSLREESQLLASQF 165 44444555777799*************************************************999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.847 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.52E-31 | 2 | 74 | No hit | No description |
SuperFamily | SSF55455 | 4.71E-27 | 2 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.536 | 81 | 171 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.7E-8 | 98 | 165 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MGRRKVEIKR IENKSSRQVT FSKRRGGLVE KARQLSVLCD AAVAVLVVSS SDKLYSFSSG 60 ESLTGILARY REQQVEEDVK DLDLRLESGN YLSTKELLET LESRLKEPNL GNVSIDSVNQ 120 MEWQLEGALS AARAKKTQLL MESLKALKEK ENSLREESQL LASQFGGETL VGAEAEKEKA 180 TPPENNLSGE DRRRRPETLL LLT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-17 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6byy_B | 2e-17 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6byy_C | 2e-17 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6byy_D | 2e-17 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6bz1_A | 3e-17 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6bz1_B | 3e-17 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6bz1_C | 3e-17 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6bz1_D | 3e-17 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010519728.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010519728.1 | 1e-141 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
Refseq | XP_019056863.1 | 1e-141 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
Swissprot | Q9LSR7 | 4e-63 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
TrEMBL | A0A087GE89 | 5e-68 | A0A087GE89_ARAAL; Uncharacterized protein | ||||
STRING | XP_010519728.1 | 1e-141 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM986 | 19 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77080.4 | 3e-46 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|