 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
XP_010106176.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
Family |
HSF |
Protein Properties |
Length: 95aa MW: 10739 Da PI: 9.0646 |
Description |
HSF family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
XP_010106176.1 | genome | BGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | HSF_DNA-bind | 86.9 | 2.7e-27 | 20 | 85 | 2 | 67 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE--- CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkd 67
Fl+k+y++++d+++++++sws+++nsfvv++ fa+++Lpk+Fkh+nf+SFvRQLn+Yg k++++
XP_010106176.1 20 FLSKTYDMVDDPSTDSIVSWSDHNNSFVVWNAPLFARDLLPKFFKHNNFSSFVRQLNTYGRKELSK 85
9***********************************************************887765 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0005634 | Cellular Component | nucleus |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}. |
Publications
? help Back to Top |
- Hsu SF,Jinn TL
AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs. Plant Signal Behav, 2010. 5(8): p. 1042-4 [PMID:20657173] - Liu HC,Charng YY
Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] - Li S, et al.
HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis. Plant Cell, 2014. 26(4): p. 1764-1780 [PMID:24728648] - Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ
Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors. J. Exp. Bot., 2016. 67(21): p. 6139-6148 [PMID:27811081]
|