 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
XP_010096858.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
| Family |
HSF |
| Protein Properties |
Length: 125aa MW: 13976.9 Da PI: 4.0294 |
| Description |
HSF family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| XP_010096858.1 | genome | BGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | HSF_DNA-bind | 75.4 | 1e-23 | 48 | 106 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k++++++d++++ +isw ++g sfvv+d+ efa+ vLp+ Fkh+nf+SFvRQLn+Y
XP_010096858.1 48 FLSKTFDLVDDPAIDAIISWGSTGGSFVVWDPVEFARLVLPRNFKHNNFSSFVRQLNTY 106
9*********************************************************9 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 2ldu_A | 5e-18 | 45 | 106 | 17 | 78 | Heat shock factor protein 1 |
| 5hdg_A | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_A | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_B | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_C | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_D | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. |
| Publications
? help Back to Top |
- Jung HS, et al.
Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light.
Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9
[PMID:23918368] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Nie S,Yue H,Xing D
A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance.
Plant Physiol., 2016.
[PMID:26099269] - Hu Z, et al.
Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis.
Plant J., 2015. 84(6): p. 1178-91
[PMID:26576681] - Song C,Chung WS,Lim CO
Overexpression of Heat Shock Factor Gene HsfA3 Increases Galactinol Levels and Oxidative Stress Tolerance in Arabidopsis.
Mol. Cells, 2016. 39(6): p. 477-83
[PMID:27109422] - Kim GD,Cho YH,Lee BH,Yoo SD
STABILIZED1 Modulates Pre-mRNA Splicing for Thermotolerance.
Plant Physiol., 2017. 173(4): p. 2370-2382
[PMID:28223317] - Song C,Lee J,Kim T,Hong JC,Lim CO
VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
Planta, 2018. 247(6): p. 1439-1448
[PMID:29536220]
|
