![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010087666.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 165aa MW: 18101.3 Da PI: 7.0563 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 161.4 | 1.3e-50 | 1 | 90 | 8 | 97 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yr++eg++ XP_010087666.1 1 MPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRDAEGDR 90 8***************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 2.17E-36 | 1 | 96 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.8E-46 | 1 | 97 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.8E-26 | 1 | 64 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.1E-17 | 28 | 46 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 31 | 47 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.1E-17 | 47 | 65 | No hit | No description |
PRINTS | PR00615 | 5.1E-17 | 66 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MPIANVIRIM RKILPPHAKI SDDAKETIQE CVSEYISFIT GEANERCQRE QRKTITAEDV 60 LWAMSKLGFD DYIEPLTLYL HRYRDAEGDR SGSSSSSAVS MRGDVVPFMK RAVDYGSVAA 120 FAPAAAFHHN GFFGYFKDNN GSGAGGSGNN SLAAVSKGEQ HGQYK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-57 | 1 | 85 | 13 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010087666.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010087666.1 | 1e-122 | nuclear transcription factor Y subunit B-6 | ||||
Refseq | XP_024032383.1 | 1e-122 | nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 5e-63 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | W9QE12 | 1e-120 | W9QE12_9ROSA; Nuclear transcription factor Y subunit B-6 | ||||
STRING | XP_010087666.1 | 1e-121 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2728 | 32 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 3e-56 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 21393907 |