![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009795247.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 104aa MW: 11541.1 Da PI: 5.22 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 147.1 | 3.7e-46 | 11 | 95 | 2 | 86 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefi+fvt+eas+kc++e+rkt+ngdd++wal+tlGf+dy ++k + XP_009795247.1 11 KEQDRLLPIANVGRIMKQTLPPNAKISKEAKETMQECVSEFIGFVTGEASEKCRKERRKTVNGDDVCWALGTLGFDDYGGTMKRF 95 89****************************************************************************9999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.0E-43 | 4 | 94 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.71E-32 | 13 | 94 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.5E-27 | 16 | 80 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.2E-9 | 44 | 62 | No hit | No description |
PRINTS | PR00615 | 3.2E-9 | 63 | 81 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MAQNDEGSNS KEQDRLLPIA NVGRIMKQTL PPNAKISKEA KETMQECVSE FIGFVTGEAS 60 EKCRKERRKT VNGDDVCWAL GTLGFDDYGG TMKRFELSTC GTMN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-39 | 11 | 95 | 2 | 86 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-39 | 11 | 95 | 2 | 86 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975513 | 2e-69 | HG975513.1 Solanum lycopersicum chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009795246.1 | 5e-73 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Refseq | XP_009795247.1 | 5e-73 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Refseq | XP_016458530.1 | 5e-73 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 1e-48 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1S3Z287 | 1e-71 | A0A1S3Z287_TOBAC; nuclear transcription factor Y subunit B-5-like | ||||
TrEMBL | A0A1U7Y014 | 1e-71 | A0A1U7Y014_NICSY; nuclear transcription factor Y subunit B-5-like | ||||
STRING | XP_009795246.1 | 2e-72 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-51 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|