![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009793493.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 114aa MW: 12655.4 Da PI: 4.3531 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 33.3 | 1.4e-10 | 1 | 37 | 61 | 97 |
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelall 97 +vyeA ar+rdPvyG+vg+i+++q+++ +l++el+++ XP_009793493.1 1 MVYEATARLRDPVYGCVGIISAVQKHVFHLQSELNEA 37 69*******************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 4.9E-9 | 1 | 36 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 8.815 | 1 | 41 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MVYEATARLR DPVYGCVGII SAVQKHVFHL QSELNEALAE AMFLRTQLSD ALSLPSLIEG 60 SPFTPENHEF LHFQKPSEQN AYANASDALL LLPEAADHYC LQGTEVLPLP YLDI |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975445 | 9e-69 | HG975445.1 Solanum pennellii chromosome ch06, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009793493.1 | 4e-79 | PREDICTED: LOB domain-containing protein 4-like | ||||
Refseq | XP_016503569.1 | 3e-78 | PREDICTED: LOB domain-containing protein 25-like isoform X1 | ||||
Refseq | XP_016503570.1 | 3e-78 | PREDICTED: LOB domain-containing protein 25-like isoform X2 | ||||
TrEMBL | A0A1S4CR38 | 6e-77 | A0A1S4CR38_TOBAC; LOB domain-containing protein 25-like isoform X2 | ||||
TrEMBL | A0A1S4CRC5 | 7e-77 | A0A1S4CRC5_TOBAC; LOB domain-containing protein 25-like isoform X1 | ||||
TrEMBL | A0A1U7XRF5 | 9e-78 | A0A1U7XRF5_NICSY; LOB domain-containing protein 4-like | ||||
STRING | XP_009793493.1 | 2e-78 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA13147 | 14 | 19 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30340.1 | 2e-12 | LOB domain-containing protein 13 |