![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009782865.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 102aa MW: 11479.8 Da PI: 6.0797 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 106.2 | 2e-33 | 37 | 93 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY+eC+kNhAas+Gg+avDGC+Efmp +eegt+ al+CaACgCHRnFHRreve+e XP_009782865.1 37 TVRYRECQKNHAASVGGYAVDGCREFMPC-DEEGTPGALTCAACGCHRNFHRREVETE 93 79**************************9.999*********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 2.0E-26 | 11 | 101 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.6E-30 | 38 | 90 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 7.5E-28 | 39 | 90 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.03 | 40 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MCHLSFQTKE MTKRQVILKK DDFSDDDSTN SSFTIRTVRY RECQKNHAAS VGGYAVDGCR 60 EFMPCDEEGT PGALTCAACG CHRNFHRREV ETEVACDCSF PT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009782865.1 | 8e-72 | PREDICTED: mini zinc finger protein 2 | ||||
Refseq | XP_016440003.1 | 8e-72 | PREDICTED: mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 2e-36 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A1S3XJB4 | 2e-70 | A0A1S3XJB4_TOBAC; mini zinc finger protein 2-like | ||||
TrEMBL | A0A1U7X8T6 | 2e-70 | A0A1U7X8T6_NICSY; mini zinc finger protein 2 | ||||
STRING | XP_009782865.1 | 3e-71 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 2e-36 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|