PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MYB

Protein Properties

Length: 127aa MW: 14623.8 Da PI: 8.7142

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009766825.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.1	6.3e-16	22	69	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l v+++G +W +++ g+ R++k+c++rw +yl XP_009766825.1 22 KGAWSEEEDNKLRAFVEKHGHSNWLQLPKYAGQMRCGKSCRLRWMNYL 69 79********************************************97 PP
2	Myb_DNA-binding	38.3	3.1e-12	75	110	1	38
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38 +g+ + eE+el+++++++lG++ W+ Ia+ ++ gR+++ XP_009766825.1 75 KGNYSHEEEELIIKLHNELGNR-WSVIAEQLP-GRSDN 110 7899****************.*****.*97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.8E-21	15	71	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.921	17	73	IPR017930	Myb domain
SuperFamily	SSF46689	1.39E-27	19	110	IPR009057	Homeodomain-like
SMART	SM00717	7.3E-13	21	71	IPR001005	SANT/Myb domain
Pfam	PF00249	3.8E-15	22	69	IPR001005	SANT/Myb domain
CDD	cd00167	1.51E-10	24	69	No hit	No description
PROSITE profile	PS50090	8.502	70	110	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	2.5E-18	72	110	IPR009057	Homeodomain-like
SMART	SM00717	0.0044	74	122	IPR001005	SANT/Myb domain
Pfam	PF00249	3.4E-11	75	110	IPR001005	SANT/Myb domain
CDD	cd00167	4.26E-7	77	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 127 aa Download sequence Send to blast
MVLIIAKKMV RTPSIDKNGM KKGAWSEEED NKLRAFVEKH GHSNWLQLPK YAGQMRCGKS 60 CRLRWMNYLR PGLKKGNYSH EEEELIIKLH NELGNRWSVI AEQLPGRSDN VGVEGFEPEG 120 FEADNLI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-22	22	111	7	95	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:19517001, ECO:0000305\|PubMed:12857823}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:12857823, ECO:0000269\|PubMed:19517001, ECO:0000269\|PubMed:8980549}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009766825.1	2e-90	PREDICTED: myb-related protein Myb4-like
Refseq	XP_016452268.1	2e-90	PREDICTED: myb-related protein Myb4-like
Swissprot	Q9LDR8	2e-43	MY102_ARATH; Transcription factor MYB102
TrEMBL	A0A1S3YJP3	5e-89	A0A1S3YJP3_TOBAC; myb-related protein Myb4-like
TrEMBL	A0A1U7VXW2	5e-89	A0A1U7VXW2_NICSY; myb-related protein Myb4-like
STRING	XP_009766825.1	8e-90	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G21440.1	7e-46	MYB-like 102

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615] Zhu L,Guo J,Ma Z,Wang J,Zhou C Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis. Biomolecules, 2019. [PMID:29880735]