PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

SBP

Protein Properties

Length: 133aa MW: 15270 Da PI: 8.6211

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009763062.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	140.5	4.6e-44	49	124	2	77
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqve+C+ad++ ak yhrrhkvCe+hskapvvl+sg++qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk++ XP_009763062.1 49 CQVEQCTADMAGAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQLPEFDEAKRSCRRRLAGHNERRRKTS 124 **************************************************************************87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	8.1E-58	1	133	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	1.8E-36	42	110	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.641	46	123	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	9.81E-41	47	127	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	9.1E-34	49	122	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009908	Biological Process	flower development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 133 aa Download sequence Send to blast
MEDNKWEGKR SMNEAEEEHE NAEEDNKRKR VLTLSGRNLS GGGPALPSCQ VEQCTADMAG 60 AKPYHRRHKV CEFHSKAPVV LISGIQQRFC QQCSRFHQLP EFDEAKRSCR RRLAGHNERR 120 RKTSYDSHGE SSS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	4e-40	40	122	2	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LC072722	0.0	LC072722.1 Nicotiana tabacum NtabSPL3a mRNA for squamosa promoter binding protein NtabSPL3a, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009763062.1	6e-96	PREDICTED: squamosa promoter-binding protein 1-like isoform X2
Refseq	XP_016491740.1	6e-96	PREDICTED: squamosa promoter-binding protein 1-like
Swissprot	Q38741	8e-55	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A125SZM9	1e-94	A0A125SZM9_TOBAC; Squamosa promoter-binding-like protein
TrEMBL	A0A1U7V4D5	1e-94	A0A1U7V4D5_NICSY; Squamosa promoter-binding-like protein
STRING	XP_009763061.1	3e-83	(Nicotiana sylvestris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	3e-44	squamosa promoter binding protein-like 3

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]