PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

NF-YB

Protein Properties

Length: 160aa MW: 18199.5 Da PI: 6.5352

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009620709.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	172.4	4.9e-54	24	119	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdr+lPianv+rimk++lP+nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal +lGf++y+eplk yl+ yre ege XP_009620709.1 24 KEQDRLLPIANVGRIMKQILPQNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALENLGFDNYAEPLKRYLQSYRESEGE 118 89*******************************************************************************************99 PP NF-YB 97 k 97 k XP_009620709.1 119 K 119 7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	9.4E-56	19	142	IPR009072	Histone-fold
SuperFamily	SSF47113	1.65E-42	26	142	IPR009072	Histone-fold
Pfam	PF00808	5.4E-28	29	93	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.7E-19	57	75	No hit	No description
PROSITE pattern	PS00685	0	60	76	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.7E-19	76	94	No hit	No description
PRINTS	PR00615	1.7E-19	95	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MVDNINILGS IPKHNPISEE GGIKEQDRLL PIANVGRIMK QILPQNAKIS KEAKETMQEC 60 VSEFISFVTG EASDKCHKEK RKTVNGDDIC WALENLGFDN YAEPLKRYLQ SYRESEGEKA 120 NQNKAVTGNN TEEREKDEPQ RKSTVLPTQF RNLQGRFYGP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-45	23	114	1	92	Transcription factor HapC (Eurofung)
4g92_B	3e-45	23	114	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM437217	5e-34	AM437217.2 Vitis vinifera contig VV78X191396.14, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009620709.1	1e-117	PREDICTED: nuclear transcription factor Y subunit B-4-like
Refseq	XP_016450626.1	1e-117	PREDICTED: nuclear transcription factor Y subunit B-4-like
Swissprot	O82248	5e-58	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A1S3YEG5	1e-115	A0A1S3YEG5_TOBAC; nuclear transcription factor Y subunit B-4-like
STRING	XP_009620709.1	1e-116	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	2e-60	nuclear factor Y, subunit B5

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]