PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

LBD

Protein Properties

Length: 227aa MW: 25071 Da PI: 8.4115

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009611387.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	146.6	7e-46	13	112	1	100
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l+ XP_009611387.1 13 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLS 107 7********************************************************************************************** PP DUF260 96 llkee 100 +k+e XP_009611387.1 108 CAKSE 112 99987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	27.22	12	113	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	4.5E-45	13	110	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009799	Biological Process	specification of symmetry
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:0009954	Biological Process	proximal/distal pattern formation
GO:0048441	Biological Process	petal development
GO:0005654	Cellular Component	nucleoplasm

Sequence ? help Back to Top
Protein Sequence Length: 227 aa Download sequence Send to blast
MSSSSSSLSS NSPCAACKFL RRKCQPECVF APYFPPDQPQ KFANVHKVFG ASNVTKLLNE 60 LQPHQREDAV NSLAYEADMR LRDPVYGCVG VISLLQHQLR QLQMDLSCAK SELSKYQNLG 120 GIAGTTTHGL LAAAAAAAAT TAHHHQQFNF MAGGGRDHHH HLYHHHQFFP RDQSQQQQQH 180 HQHMIRAFEG HGSNNFDASS LLIGQLSQFQ QPRAAGGDGR RTPVDPS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	9e-58	3	122	1	122	LOB family transfactor Ramosa2.1
5ly0_B	9e-58	3	122	1	122	LOB family transfactor Ramosa2.1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 1 (AS1) to repress the knox homeobox genes KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11311158, PubMed:12787254, PubMed:12874130, PubMed:14508003, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509). Required for the binding of AS1 to the KNOX genes (PubMed:23271976). Involved in leaf polarity establishment by functioning cooperatively with RH10 or RID2 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269\|PubMed:11311158, ECO:0000269\|PubMed:12787254, ECO:0000269\|PubMed:12874130, ECO:0000269\|PubMed:14508003, ECO:0000269\|PubMed:16006579, ECO:0000269\|PubMed:16699177, ECO:0000269\|PubMed:17395603, ECO:0000269\|PubMed:17559509, ECO:0000269\|PubMed:23271976, ECO:0000269\|PubMed:27334696}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00211	DAP	Transfer from AT1G65620	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by SHOOT MERISTEMLESS (STM). {ECO:0000269\|PubMed:11934861}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009611386.1	1e-168	PREDICTED: LOB domain-containing protein 6-like
Refseq	XP_016481112.1	1e-168	PREDICTED: LOB domain-containing protein 6-like
Swissprot	O04479	1e-86	AS2_ARATH; Protein ASYMMETRIC LEAVES 2
TrEMBL	A0A1S4AWV7	1e-167	A0A1S4AWV7_TOBAC; LOB domain-containing protein 6-like
STRING	XP_009611386.1	1e-167	(Nicotiana tomentosiformis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G65620.4	1e-75	LBD family protein

Publications ? help Back to Top
Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Mateo-Bonmatí E, et al. Plastid control of abaxial-adaxial patterning. Sci Rep, 2015. 5: p. 15975 [PMID:26522839] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Matsumura Y, et al. A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis. Biol Open, 2016. 5(7): p. 942-54 [PMID:27334696] Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana. Plant Mol. Biol., 2016. 92(6): p. 661-674 [PMID:27605094] Vial-Pradel S, et al. Arabidopsis Zinc-Finger-Like Protein ASYMMETRIC LEAVES2 (AS2) and Two Nucleolar Proteins Maintain Gene Body DNA Methylation in the Leaf Polarity Gene ETTIN (ARF3). Plant Cell Physiol., 2018. 59(7): p. 1385-1397 [PMID:29415182] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]