![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009609750.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 111aa MW: 12268.8 Da PI: 6.3358 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 59.6 | 9.1e-19 | 1 | 55 | 46 | 100 |
DUF260 46 lkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la++++e XP_009609750.1 1 MQELPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDMLRTQLAMAQAE 55 6899**********************************************99976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 1.2E-16 | 1 | 53 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 11.676 | 1 | 56 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MQELPEHKRG DAVSSMVYEA NARVRDPVYG CVGAISSLQQ QIDMLRTQLA MAQAEVVHLR 60 LRQSAGITNS PINSGSPSSH IMGSHQPKGY FHMDLDVDQS NNGFNEPMWP C |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-18 | 1 | 70 | 56 | 125 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-18 | 1 | 70 | 56 | 125 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009609750.1 | 2e-79 | PREDICTED: LOB domain-containing protein 4-like | ||||
Swissprot | Q9SHE9 | 4e-29 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A1S3YUV2 | 9e-77 | A0A1S3YUV2_TOBAC; LOB domain-containing protein 4-like | ||||
STRING | XP_009609750.1 | 6e-79 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 2e-31 | LOB domain-containing protein 4 |