![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009606377.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 182aa MW: 21352.6 Da PI: 9.8531 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87 | 1e-27 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n+s rqvtfskRrng+lKKA+EL +LCda+v +iifsst klye+s+ XP_009606377.1 10 RIDNSSSRQVTFSKRRNGLLKKAKELAILCDAQVGLIIFSSTEKLYEFSN 59 8***********************************************95 PP | |||||||
2 | K-box | 73.9 | 4.5e-25 | 81 | 170 | 9 | 98 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + ++ + +q+e+a L++++++Lq+++R+++Ge+L L++k+Lq+Le++Le+s++ iR kK+++l+++i+el k +++en +L +k+ XP_009606377.1 81 NPVSELKLWQKEAAILRQQLQELQQNHRQVMGEQLYGLTIKDLQNLENRLETSIRGIRMKKEQILHDEIQELSLKGSLMHQENLELFHKV 170 45677899*****************************************************************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.628 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.36E-32 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.34E-42 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 3.8E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.4E-22 | 85 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.768 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MGRGKIVIRR IDNSSSRQVT FSKRRNGLLK KAKELAILCD AQVGLIIFSS TEKLYEFSNT 60 SMKSVVERYN KTKDEHHQLQ NPVSELKLWQ KEAAILRQQL QELQQNHRQV MGEQLYGLTI 120 KDLQNLENRL ETSIRGIRMK KEQILHDEIQ ELSLKGSLMH QENLELFHKV NIIQQENVDL 180 YI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 4e-21 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6bz1_B | 4e-21 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6bz1_C | 4e-21 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6bz1_D | 4e-21 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009606377.1 | 1e-130 | PREDICTED: MADS-box transcription factor 27-like isoform X3 | ||||
Swissprot | Q6EP49 | 5e-91 | MAD27_ORYSJ; MADS-box transcription factor 27 | ||||
TrEMBL | A0A1S3ZEC9 | 1e-118 | A0A1S3ZEC9_TOBAC; MADS-box transcription factor 23-like isoform X1 | ||||
STRING | XP_009606375.1 | 1e-119 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37940.1 | 3e-85 | AGAMOUS-like 21 |
Publications ? help Back to Top | |||
---|---|---|---|
|