PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009598900.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 150aa MW: 16907.2 Da PI: 6.7658 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 21.6 | 5e-07 | 108 | 139 | 4 | 36 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRt 36 W ++E+ ll+++ +++G +W+ +a+++g ++ XP_009598900.1 108 WNADEEMLLLEGMEMYGLANWAEVAEHVG-TKM 139 *****************************.765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00291 | 3.2E-10 | 44 | 88 | IPR000433 | Zinc finger, ZZ-type |
Pfam | PF00569 | 7.8E-11 | 46 | 88 | IPR000433 | Zinc finger, ZZ-type |
CDD | cd02335 | 2.06E-24 | 48 | 96 | No hit | No description |
SuperFamily | SSF57850 | 3.65E-15 | 48 | 111 | No hit | No description |
PROSITE profile | PS50135 | 10.846 | 48 | 91 | IPR000433 | Zinc finger, ZZ-type |
PROSITE pattern | PS01357 | 0 | 50 | 77 | IPR000433 | Zinc finger, ZZ-type |
SuperFamily | SSF46689 | 2.69E-7 | 100 | 140 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 13.878 | 103 | 150 | IPR017884 | SANT domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-5 | 107 | 144 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-6 | 108 | 140 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.76E-7 | 108 | 138 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MGRSRAVHQS ADDDPSQRSK RKRTVPNVEN FDTAAAGQVL SDGKKALYHC NYCNKDISGR 60 IRIKCAVCSD FDLCVECFSV GAEVQPHKSN HLYRVMDNLS FPLICADWNA DEEMLLLEGM 120 EMYGLANWAE VAEHVGTKMQ HYIKGFNMKS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6cw3_E | 1e-31 | 48 | 146 | 5 | 108 | Transcriptional adapter 2 |
6cw3_G | 1e-31 | 48 | 146 | 5 | 108 | Transcriptional adapter 2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT014608 | 1e-168 | BT014608.1 Lycopersicon esculentum clone 134091F, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009598900.1 | 1e-111 | PREDICTED: transcriptional adapter ADA2-like isoform X4 | ||||
Swissprot | Q75LL6 | 1e-63 | TADA2_ORYSJ; Transcriptional adapter ADA2 | ||||
TrEMBL | A0A1S3XXH2 | 7e-98 | A0A1S3XXH2_TOBAC; Transcriptional adapter | ||||
STRING | XP_009803647.1 | 3e-97 | (Nicotiana sylvestris) | ||||
STRING | XP_009598897.1 | 1e-100 | (Nicotiana tomentosiformis) |
Publications ? help Back to Top | |||
---|---|---|---|
|