PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009593604.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 147aa MW: 17137.8 Da PI: 10.4725 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 136.6 | 7.7e-43 | 25 | 100 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqv+gC++dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh lsefD++krsCr+rLa+hnerrrk++ XP_009593604.1 25 CQVQGCRKDLSSSKDYHKRHKVCEVHSKTAKVIVNGTEQRFCQQCSRFHLLSEFDNGKRSCRKRLAGHNERRRKPH 100 **************************************************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 4.8E-35 | 20 | 86 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.812 | 22 | 99 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.57E-39 | 23 | 102 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 6.4E-33 | 25 | 98 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MTNLSSNLPA KRMRTAGLKY QTPYCQVQGC RKDLSSSKDY HKRHKVCEVH SKTAKVIVNG 60 TEQRFCQQCS RFHLLSEFDN GKRSCRKRLA GHNERRRKPH TGRRSDMECL NITSTQLFTD 120 SFYSIQKKLA IFFFVFLFLT TIGVFDC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-30 | 25 | 98 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LC073303 | 1e-122 | LC073303.1 Nicotiana tabacum NtabSPL6-2 mRNA for squamosa promoter binding protein NtabSPL6-2, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009777336.1 | 3e-62 | PREDICTED: squamosa promoter-binding-like protein 6 isoform X2 | ||||
Swissprot | Q94JW8 | 1e-46 | SPL6_ARATH; Squamosa promoter-binding-like protein 6 | ||||
TrEMBL | A0A1U7WJ90 | 6e-61 | A0A1U7WJ90_NICSY; squamosa promoter-binding-like protein 6 isoform X2 | ||||
STRING | XP_009593604.1 | 1e-106 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6831 | 19 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69170.1 | 9e-49 | SBP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|