PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MIKC_MADS

Protein Properties

Length: 248aa MW: 28664.3 Da PI: 9.8855

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009586723.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.3	1.6e-31	25	74	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ XP_009586723.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 74 79***********************************************8 PP
2	K-box	115	7.3e-38	93	189	4	100
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 s++ s +ea+a+++qqe++kL+++i nLq+++R++lGe+L Lsl++L++Leq++ek+++kiRskKnell+++ie++qk+e +l+++n++Lr+k+ XP_009586723.1 93 SNTGSISEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKREIDLHNNNQYLRAKI 187 4444599***************************************************************************************9 PP K-box 99 ee 100 +e XP_009586723.1 188 AE 189 86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.4E-41	17	76	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.669	17	77	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.20E-45	18	94	No hit	No description
SuperFamily	SSF55455	3.27E-33	18	90	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	19	73	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.6E-33	19	39	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.3E-27	26	73	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.6E-33	39	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.6E-33	54	75	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	2.0E-27	101	187	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.263	103	193	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048366	Biological Process	leaf development
GO:0048440	Biological Process	carpel development
GO:0048443	Biological Process	stamen development
GO:0048497	Biological Process	maintenance of floral organ identity
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 248 aa Download sequence Send to blast
MDFQSDLTRE ISPQRKLGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LIVFSSRGRL YEYANNSVKA TIERYKKACS DSSNTGSISE ANAQYYQQEA SKLRAQIGNL 120 QNQNRNMLGE SLAALSLRDL KNLEQKIEKG ISKIRSKKNE LLFAEIEYMQ KREIDLHNNN 180 QYLRAKIAET ERAQQQQQQQ QMNLMPGSSS YELVPPPHQF DTRNYLQVNG LQTNNHYTRQ 240 DQPSLQLV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
5f28_A	2e-20	17	85	1	69	MEF2C
5f28_B	2e-20	17	85	1	69	MEF2C
5f28_C	2e-20	17	85	1	69	MEF2C
5f28_D	2e-20	17	85	1	69	MEF2C
6c9l_A	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00609	ChIP-seq	Transfer from AT4G18960	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	TOBNAG1A	0.0	L23925.1 Nicotiana tabacum NAG1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001312829.1	0.0	floral homeotic protein AGAMOUS
Refseq	XP_009586722.1	0.0	PREDICTED: floral homeotic protein AGAMOUS isoform X2
Refseq	XP_009586723.1	0.0	PREDICTED: floral homeotic protein AGAMOUS isoform X3
Refseq	XP_016493540.1	0.0	PREDICTED: floral homeotic protein AGAMOUS isoform X2
Swissprot	Q43585	0.0	AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBL	A0A1S4BXB7	0.0	A0A1S4BXB7_TOBAC; floral homeotic protein AGAMOUS isoform X1
STRING	XP_009586720.1	1e-174	(Nicotiana tomentosiformis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	1e-123	MIKC_MADS family protein

Publications ? help Back to Top
Cheung AY,Zhan XY,Wang H,Wu HM Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein. Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8 [PMID:8632979]