PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

LBD

Protein Properties

Length: 121aa MW: 13593.8 Da PI: 8.689

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009152040.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	125.1	3.3e-39	5	104	1	100
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrr+C+kdC+++pyfp +p kfa++h+++Ga nv+k+l++lp ++r +a++sl +eA++r++dPvyG+vg+i+ lq +++++++ la XP_009152040.1 5 RCAACKYLRRRCPKDCIFSPYFPPGDPDKFACIHRIYGAGNVSKMLQQLPVQTRAEAVESLSFEAKCRVEDPVYGCVGIISLLQTEIQKTQTLLA 99 6*******************************************************************************************999 PP DUF260 96 llkee 100 ++++e XP_009152040.1 100 RTQAE 104 99887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	23.499	4	105	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.9E-38	5	102	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0016020	Cellular Component	membrane

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
MNPKRCAACK YLRRRCPKDC IFSPYFPPGD PDKFACIHRI YGAGNVSKML QQLPVQTRAE 60 AVESLSFEAK CRVEDPVYGC VGIISLLQTE IQKTQTLLAR TQAEIAVAQA KHSQTQVNEF 120 M

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	5e-37	6	105	12	111	LOB family transfactor Ramosa2.1
5ly0_B	5e-37	6	105	12	111	LOB family transfactor Ramosa2.1
Search in ModeBase

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00381	DAP	Transfer from AT3G26620	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009152040.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB473847	1e-109	AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds.
GenBank	DQ056609	1e-109	DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009152040.1	1e-86	PREDICTED: LOB domain-containing protein 23
Refseq	XP_013644728.1	1e-86	LOB domain-containing protein 23
Refseq	XP_022543623.1	1e-86	LOB domain-containing protein 23-like
Swissprot	P59467	4e-74	LBD23_ARATH; LOB domain-containing protein 23
Swissprot	P59468	5e-74	LBD24_ARATH; LOB domain-containing protein 24
TrEMBL	A0A078FKY4	2e-85	A0A078FKY4_BRANA; BnaA06g32760D protein
TrEMBL	A0A291LR06	2e-85	A0A291LR06_BRARR; Transcription factor LBD24
TrEMBL	A0A397ZCU9	2e-85	A0A397ZCU9_BRACM; Uncharacterized protein
STRING	Bo7g083780.1	3e-80	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM131	28	340

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G26620.1	2e-76	LOB domain-containing protein 23