![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009140311.1 | ||||||||
Common Name | WRKY59 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 196aa MW: 22638.4 Da PI: 6.9531 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 95.7 | 3.2e-30 | 104 | 162 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+++gs+fpr+Y++C+ a+C vkkk+er++++p++v +tYeg+Hnh+ XP_009140311.1 104 LDDGFKWRKYGKKPIRGSPFPRHYHKCSNANCIVKKKIERDTSNPDYVLTTYEGRHNHP 162 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.0E-27 | 97 | 164 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.747 | 99 | 164 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.4E-25 | 100 | 164 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.9E-31 | 104 | 163 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.9E-22 | 105 | 162 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MNYPSNPNPN FIDFPITFTS DDYDDAFQMI MEQISLENHS PTLSWTSSEK LLAAEVTSPL 60 QTSLVTSPMS LEIEDKTEIK KRKRHKDDPI IHVFKTKSIE EIALDDGFKW RKYGKKPIRG 120 SPFPRHYHKC SNANCIVKKK IERDTSNPDY VLTTYEGRHN HPSPSVVYCD SDDFDLTSLN 180 ILSFQTRTYK YSHSAP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-21 | 104 | 165 | 17 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-21 | 104 | 165 | 17 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00270 | DAP | Transfer from AT2G21900 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009140311.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF430066 | 0.0 | KF430066.1 Brassica rapa WRKY transcription factor 59 (WRKY59) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001288993.1 | 1e-145 | probable WRKY transcription factor 59 | ||||
Swissprot | Q9SJ09 | 5e-92 | WRK59_ARATH; Probable WRKY transcription factor 59 | ||||
TrEMBL | A0A078FSM5 | 1e-144 | A0A078FSM5_BRANA; BnaA04g12540D protein | ||||
TrEMBL | M4ENA3 | 1e-144 | M4ENA3_BRARP; Uncharacterized protein | ||||
TrEMBL | V5RF01 | 1e-144 | V5RF01_BRACM; WRKY transcription factor 59 | ||||
STRING | Bra030273.1-P | 1e-144 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13835 | 17 | 26 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21900.1 | 2e-94 | WRKY DNA-binding protein 59 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 103864303 |
Publications ? help Back to Top | |||
---|---|---|---|
|