![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009129496.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 121aa MW: 13836.1 Da PI: 8.7745 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 124.2 | 6.5e-39 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaC++lrr+C+kdCv++p fp ++p+kfa+vh+++Ga nv+k+l++lp ++r +a++sl++eA +r++dPvyG+vg+i+ lq q+++++ la XP_009129496.1 5 RCAACRYLRRRCPKDCVFSPFFPPNNPEKFACVHRIYGAGNVSKMLQQLPVQTRAEAVESLCFEATCRIEDPVYGCVGMISLLQTQIQKTERLLA 99 6*****************************************************************************************99999 PP DUF260 96 llkee 100 ++++e XP_009129496.1 100 RTQAE 104 98876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.272 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 8.3E-39 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MNPKRCAACR YLRRRCPKDC VFSPFFPPNN PEKFACVHRI YGAGNVSKML QQLPVQTRAE 60 AVESLCFEAT CRIEDPVYGC VGMISLLQTQ IQKTERLLAR TQAEITVSQI KHSQNQHSEF 120 M |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-36 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-36 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009129496.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009129493.1 | 1e-86 | PREDICTED: LOB domain-containing protein 24-like | ||||
Refseq | XP_022560764.1 | 1e-86 | LOB domain-containing protein 24 | ||||
Refseq | XP_022566658.1 | 1e-86 | LOB domain-containing protein 24-like | ||||
Swissprot | P59468 | 6e-73 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A398AEN5 | 8e-86 | A0A398AEN5_BRACM; Uncharacterized protein | ||||
STRING | Bo00285s360.1 | 2e-84 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 1e-63 | LOB domain-containing protein 24 |