![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009129401.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 132aa MW: 14678.5 Da PI: 7.4056 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 139.8 | 9e-44 | 12 | 110 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrr+C++dCv+apyfp ++p kfanvh++FGasnv+k+l+++ +++red+++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el+ XP_009129401.1 12 PCAACKFLRRRCTSDCVFAPYFPPDEPTKFANVHRIFGASNVSKILHEVAPHQREDTVNSLAYEAEARLNDPVYGCVGAISVLQRQVLKLQRELE 106 7*********************************************************************************************9 PP DUF260 96 llke 99 ++++ XP_009129401.1 107 ETNA 110 9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.908 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.9E-43 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MASSYSNYIN SPCAACKFLR RRCTSDCVFA PYFPPDEPTK FANVHRIFGA SNVSKILHEV 60 APHQREDTVN SLAYEAEARL NDPVYGCVGA ISVLQRQVLK LQRELEETNA DLMRYASSLG 120 GEMTSNYGGH RG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-58 | 10 | 125 | 9 | 125 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-58 | 10 | 125 | 9 | 125 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009129401.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009129401.1 | 4e-96 | PREDICTED: LOB domain-containing protein 25-like | ||||
Refseq | XP_013697798.1 | 4e-96 | LOB domain-containing protein 25-like | ||||
Refseq | XP_013697803.1 | 4e-96 | LOB domain-containing protein 25-like | ||||
Swissprot | Q8L8Q3 | 1e-84 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
TrEMBL | A0A291LR89 | 1e-94 | A0A291LR89_BRARR; Transcription factor LBD25b | ||||
TrEMBL | A0A398AEX0 | 1e-94 | A0A398AEX0_BRACM; Uncharacterized protein | ||||
TrEMBL | M4EW36 | 1e-94 | M4EW36_BRARP; Uncharacterized protein | ||||
STRING | Bra033019.1-P | 2e-95 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27650.1 | 5e-87 | LOB domain-containing protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|