![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009129054.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 179aa MW: 20895.2 Da PI: 6.7967 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 41.1 | 3.7e-13 | 86 | 144 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +++rr+ +NRe+ArrsR RK+ ++eL v L +eN L+++l++ +++ +++ +e+ XP_009129054.1 86 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQDSVLKEN 144 79************************************************999888775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.0E-14 | 82 | 146 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.795 | 84 | 147 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.11E-12 | 86 | 135 | No hit | No description |
Pfam | PF00170 | 4.8E-11 | 86 | 144 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.7E-10 | 86 | 135 | No hit | No description |
CDD | cd14702 | 1.71E-17 | 87 | 135 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 89 | 104 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MIPAEITGYY QYLSPENLGT LPTEFNIINM PSSPTSSSSL TYLNDLINNN YSSSSIRQDL 60 MMGNNSTSDE DHQHHHHQSI IIVDERKQRR MLSNRESARR SRMRKQRHLD ELWSQVIRLR 120 NENNCLIDKL NRVSETQDSV LKENSKLKEE ASELRQLVCE LKSNKNSDDD NNFVRKLSE |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 98 | 105 | RRSRMRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bra.21822 | 0.0 | bud| root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00647 | PBM | Transfer from LOC_Os02g49560 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009129054.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009129054.1 | 1e-128 | PREDICTED: basic leucine zipper 43 | ||||
Refseq | XP_013720642.1 | 1e-128 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 6e-31 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A078I9F3 | 1e-127 | A0A078I9F3_BRANA; BnaA02g27460D protein | ||||
TrEMBL | A0A398ALG3 | 1e-127 | A0A398ALG3_BRACM; Uncharacterized protein | ||||
STRING | Bo2g138370.1 | 1e-122 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2892 | 24 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G04038.1 | 1e-66 | basic leucine-zipper 48 |
Publications ? help Back to Top | |||
---|---|---|---|
|