PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009128989.1

Organism

Brassica rapa

Taxonomic ID

3711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NF-YB

Protein Properties

Length: 186aa MW: 19929.9 Da PI: 6.3575

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009128989.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	185.5	4e-58	21	116	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+ege XP_009128989.1 21 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGE 115 89********************************************************************************************9 PP NF-YB 97 k 97 + XP_009128989.1 116 R 116 7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	4.5E-54	16	122	IPR009072	Histone-fold
SuperFamily	SSF47113	3.42E-41	23	131	IPR009072	Histone-fold
Pfam	PF00808	1.1E-28	26	90	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	7.0E-21	54	72	No hit	No description
PROSITE pattern	PS00685	0	57	73	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	7.0E-21	73	91	No hit	No description
PRINTS	PR00615	7.0E-21	92	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
MGDSDKDSGG GQNGQSPLSP REQDRFLPIA NVSRIMKKAL PANAKISKDA KETMQECVSE 60 FISFVTGEAS DKCQKEKRKT INGDDLLWAM TTLGFEDYVE PLKVYLQRFR EIEGERAGLG 120 RPQTGGEGGE HQRDVGVGDG GGFYGGGGMQ YHQHHQFLQQ QNHMYGSTGG GGGDGGGGAG 180 SGRTRT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	8e-49	21	111	2	92	Transcription factor HapC (Eurofung)
4g92_B	8e-49	21	111	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bra.1396	0.0	bud

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in flowers and siliques. {ECO:0000269\|PubMed:11250072, ECO:0000269\|PubMed:9662544}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009128989.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC183495	0.0	AC183495.1 Brassica oleracea Contig A, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009128989.1	1e-134	PREDICTED: nuclear transcription factor Y subunit B-2-like
Swissprot	Q9FGJ3	3e-83	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBL	M4E050	1e-133	M4E050_BRARP; Uncharacterized protein
STRING	Bra022147.1-P	1e-134	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47640.1	2e-83	nuclear factor Y, subunit B2

Publications ? help Back to Top
Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]