![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009127682.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 120aa MW: 14131.9 Da PI: 9.6545 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 37.8 | 4.3e-12 | 40 | 95 | 2 | 57 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 + k+ rrk +NRe+ArrsR RK+ + eL L +eNk L +el++ ++ ++ XP_009127682.1 40 DDEKKRRRKVSNRESARRSRMRKRRHLNELWSMLVHLINENKCLVDELSRANEGYE 95 56799********************************************9988766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.5E-9 | 34 | 115 | No hit | No description |
SMART | SM00338 | 1.0E-12 | 39 | 103 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.507 | 41 | 104 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.1E-9 | 42 | 95 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.84E-10 | 43 | 92 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 46 | 61 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MDGFVYNLPG ANPNQHFFNN QVPLVNLSAT SDESNRSAED DEKKRRRKVS NRESARRSRM 60 RKRRHLNELW SMLVHLINEN KCLVDELSRA NEGYEDVVEE NKKLREENSK LRKMIGEIGF |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 42 | 47 | KKRRRK |
2 | 45 | 63 | RRKVSNRESARRSRMRKRR |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009127682.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009127682.1 | 4e-83 | PREDICTED: basic leucine zipper 8 | ||||
Swissprot | Q9CA46 | 9e-56 | BZIP8_ARATH; Basic leucine zipper 8 | ||||
TrEMBL | A0A078I9M2 | 1e-81 | A0A078I9M2_BRANA; BnaA02g14100D protein | ||||
TrEMBL | A0A3P6AV88 | 1e-81 | A0A3P6AV88_BRACM; Uncharacterized protein | ||||
TrEMBL | M4FB75 | 1e-81 | M4FB75_BRARP; Uncharacterized protein | ||||
STRING | Bra038341.1-P | 2e-82 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15035 | 16 | 19 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68880.1 | 1e-46 | basic leucine-zipper 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|