 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
XP_009117583.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
Family |
ZF-HD |
Protein Properties |
Length: 88aa MW: 9709.83 Da PI: 8.1213 |
Description |
ZF-HD family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
XP_009117583.1 | genome | NCBI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | ZF-HD_dimer | 106.6 | 1.5e-33 | 22 | 79 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
++vrY eC+kNhAa++Gg+avDGC+Efm+s g egt +al+CaACgCHRnFHR+eve+e
XP_009117583.1 22 SNVRYIECQKNHAANIGGYAVDGCREFMAS-GGEGTDDALTCAACGCHRNFHRKEVETE 79
689**************************9.8889********************9986 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:18713354}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |