![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009116115.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 110aa MW: 12360.9 Da PI: 8.0907 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 48.5 | 1.7e-15 | 23 | 61 | 2 | 41 |
TCR 2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 ++k+C+C++skClk+YC+Cfa+g+ C++ C C dC+N+++ XP_009116115.1 23 KQKRCRCRQSKCLKLYCDCFASGVLCND-CDCADCHNNTD 61 89**************************.********987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01114 | 3.5E-15 | 22 | 62 | IPR033467 | Tesmin/TSO1-like CXC domain |
PROSITE profile | PS51634 | 15.333 | 23 | 110 | IPR005172 | CRC domain |
Pfam | PF03638 | 3.2E-12 | 24 | 59 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MTSRGEREGN NNTDHQDGVT GRKQKRCRCR QSKCLKLYCD CFASGVLCND CDCADCHNNT 60 DNSYLREAAV LNLLDRNPNA FNGKPPSFSI DKQVCLKQNI VAFTHKTISE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009116115.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009114934.2 | 5e-62 | PREDICTED: protein tesmin/TSO1-like CXC 8 | ||||
Swissprot | Q700D0 | 2e-29 | TCX8_ARATH; Protein tesmin/TSO1-like CXC 8 | ||||
TrEMBL | M4DXB9 | 8e-61 | M4DXB9_BRARP; Uncharacterized protein | ||||
STRING | Bra021165.1-P | 1e-61 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14844 | 15 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G16160.1 | 3e-09 | Tesmin/TSO1-like CXC domain-containing protein |