PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

bZIP

Protein Properties

Length: 262aa MW: 29448.9 Da PI: 10.9238

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009109260.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.9	2.9e-15	193	244	5	56
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +r +r++kNRe+A rsR+RK+a++ eLe k + L+aeN +Lk + ++lk + XP_009109260.1 193 RRHKRMIKNRESAARSRARKQAYTNELELKLAHLKAENARLKRQQDQLKMVA 244 699********************************************99655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.7E-9	185	253	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.082	191	241	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.38E-10	193	241	No hit	No description
Pfam	PF00170	1.3E-12	193	241	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	7.4E-14	193	241	No hit	No description
CDD	cd14707	1.41E-25	193	247	No hit	No description
PROSITE pattern	PS00036	0	196	211	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009911	Biological Process	positive regulation of flower development
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:2000028	Biological Process	regulation of photoperiodism, flowering
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0043621	Molecular Function	protein self-association

Sequence ? help Back to Top
Protein Sequence Length: 262 aa Download sequence Send to blast
MFSSAKHQRN HRVSAPNKNK ILNKVPSISS SSSPSHSQVQ KRSLITMEEV WKDINLASIH 60 HLNHHSQHPQ HNHEPRFRSH NQNPNSIFQD FLNRPLNQEP TIPTSLSGDT TTVTALFSSS 120 PLAPPATVLS LNSSACFEFL DNEDPLVTPN SNLHSHNHLT NVCSLDTPFE ALVTSTSFGK 180 KRGQESNEGS GNRRHKRMIK NRESAARSRA RKQAYTNELE LKLAHLKAEN ARLKRQQDQL 240 KMVAANQQPK KNALQRSSTA PF

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in shoot apex. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980, ECO:0000269\|PubMed:25661797}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009109260.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB105818	1e-149	AB105818.1 Arabidopsis thaliana FD mRNA for bZIP transcription factor, complete cds, cultiva:Columbia.
GenBank	AB105819	1e-149	AB105819.1 Arabidopsis thaliana FD mRNA for bZIP transcription factor, complete cds, cultiva:Landsberg erecta.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009109260.1	0.0	PREDICTED: protein FD-like
Swissprot	Q84JK2	1e-134	FD_ARATH; Protein FD
TrEMBL	A0A397YGE3	1e-167	A0A397YGE3_BRACM; Uncharacterized protein
STRING	Bra010504.1-P	1e-144	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1934	27	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	1e-105	bZIP family protein

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]