![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009106855.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 203aa MW: 22761.4 Da PI: 6.2421 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 90.5 | 1.4e-28 | 107 | 165 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+W+KYGq+ + g++++rsYY+Ct+agC vkk+ver a++ k+++itY g+H+h+ XP_009106855.1 107 LDDGYSWKKYGQRLIMGNQNTRSYYKCTFAGCDVKKHVERRADNVKLLVITYYGNHEHD 165 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.4E-28 | 95 | 167 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.68E-25 | 101 | 167 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.334 | 102 | 167 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.1E-28 | 107 | 166 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.2E-22 | 108 | 165 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MEMTSYSASQ LIFSIAPPSP DAIIGPPEMV ESSGGNHATM MISNNGLPHQ QMDVDQAPED 60 HNIIDLNVVP SSPKTREDEV SNIIGTLRTG RYNEGVIIQM ESEENNLDDG YSWKKYGQRL 120 IMGNQNTRSY YKCTFAGCDV KKHVERRADN VKLLVITYYG NHEHDAPVQR RKCYSLKKRS 180 GSSMFQDASN RTPRVNSSEG ETV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-23 | 98 | 168 | 8 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 3e-23 | 98 | 168 | 8 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the endosperm of embryo from the two nuclei stage to the late globular embryo stage, including the endosperm cellularization time. {ECO:0000269|PubMed:16293693}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in male gametophytes (pollen) and in the endosperm of fertilized ovules. {ECO:0000269|PubMed:16293693}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Modulates seed size by negatively regulating the cellularization of syncytial endosperm (PubMed:16293693). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:16293693}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009106855.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM593143 | 0.0 | KM593143.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY40) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009106855.1 | 1e-153 | PREDICTED: probable WRKY transcription factor 10 | ||||
Swissprot | Q9LG05 | 3e-30 | WRK10_ARATH; Probable WRKY transcription factor 10 | ||||
TrEMBL | M4EPX7 | 1e-151 | M4EPX7_BRARP; Uncharacterized protein | ||||
STRING | Bra030848.1-P | 1e-152 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM19518 | 3 | 7 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G55600.1 | 1e-32 | WRKY DNA-binding protein 10 |