PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MIKC_MADS

Protein Properties

Length: 213aa MW: 24236.2 Da PI: 8.4447

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009105825.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	82.1	3.5e-26	9	57	1	49
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v+ifs++gkl+e XP_009105825.1 9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFEL 57 79********************************************996 PP
2	K-box	60.8	5.6e-21	102	182	20	100
K-box 20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 e++ Lkke+e+Lq+ +R + G + + ++l+eL Le++Le +++iRs K+e++l++i+ l++ke l+++nk+L k+ee XP_009105825.1 102 EVNVLKKEVEMLQKGIRYMFGGGDGAMNLEELLLLEKHLEYWISQIRSAKMEIMLQEIQSLRNKEGVLKNANKYLLDKIEE 182 8999**************************************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.1E-36	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-28	1	77	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.506	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.62E-40	3	78	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.7E-24	10	56	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-27	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	12.269	96	186	IPR002487	Transcription factor, K-box
Pfam	PF01486	6.2E-20	102	180	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 213 aa Download sequence Send to blast
MVRGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEIGVVIFSP QGKLFELATK 60 GTMEGVIDKY MKCTGGHRGS SSATFTSQEQ FQPPNLDPKD IEVNVLKKEV EMLQKGIRYM 120 FGGGDGAMNL EELLLLEKHL EYWISQIRSA KMEIMLQEIQ SLRNKEGVLK NANKYLLDKI 180 EENNNSILDA NFATVETNYS YIPLAMPSEI FQF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3kov_B	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3kov_I	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3kov_J	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3p57_A	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3p57_B	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3p57_C	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3p57_D	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3p57_I	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
3p57_J	9e-17	3	83	2	81	Myocyte-specific enhancer factor 2A
5f28_A	7e-17	1	83	1	82	MEF2C
5f28_B	7e-17	1	83	1	82	MEF2C
5f28_C	7e-17	1	83	1	82	MEF2C
5f28_D	7e-17	1	83	1	82	MEF2C
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bra.31554	0.0	bud

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269\|PubMed:11855641}.
Uniprot	TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269\|PubMed:11855641, ECO:0000269\|PubMed:18203871, ECO:0000269\|PubMed:7549482}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009105825.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK228190	0.0	AK228190.1 Arabidopsis thaliana mRNA for MADS-box protein AGL12, complete cds, clone: RAFL14-63-K22.
GenBank	ATU20193	0.0	U20193.1 Arabidopsis thaliana MADS-box protein AGL12 (AGL12) mRNA, complete cds.
GenBank	BT006157	0.0	BT006157.1 Arabidopsis thaliana clone RAFL17-04-C08 (R50439) putative MADS-box protein (At1g71692) mRNA, complete cds.
GenBank	BT008332	0.0	BT008332.1 Arabidopsis thaliana At1g71692 gene, complete cds.
GenBank	BT008524	0.0	BT008524.1 Arabidopsis thaliana clone U50439 putative MADS-box protein (At1g71692) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009105825.1	1e-158	PREDICTED: agamous-like MADS-box protein AGL12
Refseq	XP_013649490.1	1e-158	agamous-like MADS-box protein AGL12
Swissprot	Q38841	1e-133	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	A0A3P6C1V8	1e-141	A0A3P6C1V8_BRACM; Uncharacterized protein
STRING	Bo6g113110.1	1e-142	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7052	26	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	1e-135	AGAMOUS-like 12

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]