PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_008244405.1

Organism

Prunus mume

Taxonomic ID

102107

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

MYB

Protein Properties

Length: 224aa MW: 25548.7 Da PI: 8.8167

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_008244405.1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.5	2.7e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++ Ed+ l+d++k +G g W+ +a++ g++R++k+c++rw++yl XP_008244405.1 14 RGAWSPKEDKVLADYIKTHGEGKWSHVAKKTGLKRSGKSCRLRWLNYL 61 89********************************************97 PP
2	Myb_DNA-binding	52	1.6e-16	67	109	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg+ ++eE++l+++ +k+lG++ W++Iar+++ gRt++++k++w+ XP_008244405.1 67 RGNISPEEEDLIIRMHKLLGNR-WSLIARRLP-GRTDNEIKNFWN 109 7999****************.*****.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.094	9	61	IPR017930	Myb domain
SMART	SM00717	2.3E-14	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.52E-29	13	108	IPR009057	Homeodomain-like
Pfam	PF00249	4.3E-16	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.0E-24	15	68	IPR009057	Homeodomain-like
CDD	cd00167	7.29E-11	16	61	No hit	No description
PROSITE profile	PS51294	24.69	62	116	IPR017930	Myb domain
SMART	SM00717	4.7E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.4E-14	67	109	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.6E-24	69	115	IPR009057	Homeodomain-like
CDD	cd00167	5.78E-12	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 224 aa Download sequence Send to blast
MGRKLSGDKD VVKRGAWSPK EDKVLADYIK THGEGKWSHV AKKTGLKRSG KSCRLRWLNY 60 LRPDVKRGNI SPEEEDLIIR MHKLLGNRWS LIARRLPGRT DNEIKNFWNI NLSKRVAEAR 120 PHRIKINAKN DGADEGGNCT ANDDQVQVIQ SITLNCTKAA AMIPSHHHLH DGDKRFNIQD 180 QRVADDISSS SFLRDLDNFI NDVLHESEIN GDQNYVVDDQ EGEY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	8e-26	7	116	1	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_008244405.1

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT893409	0.0	KT893409.1 Prunus persica cultivar Jinliuzaohong r2r3-myb transcription factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008244405.1	1e-166	PREDICTED: transcription factor TT2-like
Swissprot	P10290	1e-53	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A251PNJ9	1e-152	A0A251PNJ9_PRUPE; Uncharacterized protein
STRING	XP_008244405.1	1e-165	(Prunus mume)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF17855	4	7

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G35550.1	1e-55	MYB family protein

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]