![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_008231269.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 126aa MW: 14232.3 Da PI: 6.7242 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 131.8 | 2.9e-41 | 6 | 105 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrr+C++dC+l+pyfp+++p++f vh+++Gasnv k+l++l ++ r +a+++l+yeA++r++dP+yG+vgvi++l+qq++ ++ +la XP_008231269.1 6 RCAACKYLRRRCPSDCILSPYFPSNDPQRFTSVHRIYGASNVAKMLQELLPHLRVEAAETLCYEAQCRIQDPIYGCVGVISQLHQQIQDTECQLA 100 6********************************************************************************************** PP DUF260 96 llkee 100 ++++e XP_008231269.1 101 KTRAE 105 99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.538 | 5 | 106 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.7E-41 | 6 | 103 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MNMSGRCAAC KYLRRRCPSD CILSPYFPSN DPQRFTSVHR IYGASNVAKM LQELLPHLRV 60 EAAETLCYEA QCRIQDPIYG CVGVISQLHQ QIQDTECQLA KTRAEIALMM NSDGQEPPQA 120 QVDQQI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-35 | 7 | 106 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-35 | 7 | 106 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_008231269.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008231269.1 | 4e-90 | PREDICTED: LOB domain-containing protein 24-like | ||||
Swissprot | P59468 | 5e-50 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A251Q9A6 | 1e-68 | A0A251Q9A6_PRUPE; Uncharacterized protein | ||||
STRING | XP_008231269.1 | 2e-89 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 2e-52 | LOB domain-containing protein 24 |