![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004515686.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 193aa MW: 21647.2 Da PI: 8.0924 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 24.1 | 6.2e-08 | 7 | 38 | 23 | 54 |
SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 +y+ +++ LAk++gL+ +qV++WF N R + XP_004515686.1 7 NYLIDTDKIMLAKQTGLSRNQVSNWFINARVR 38 6888889999********************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 9.961 | 1 | 42 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.37E-10 | 7 | 49 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-15 | 8 | 46 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.95E-8 | 8 | 43 | No hit | No description |
Pfam | PF05920 | 6.0E-11 | 12 | 38 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MSCKFSNYLI DTDKIMLAKQ TGLSRNQVSN WFINARVRLW KPMVEEIHML ESQQTQKEPQ 60 RDENPSTSTD KFQLRSNNNI AENPCNSTDK FHNVAYKRTR NELSNMSVLN QQVGSNGVSM 120 GSNVATSNNG VSLTLGLHQN HGIGLSEPFN MSVAQCFGLA LQPDSYVMST FQSQNRQFGR 180 DLIGGQILHD FVG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate. {ECO:0000269|PubMed:12874117, ECO:0000269|PubMed:12897247, ECO:0000269|PubMed:13678595, ECO:0000269|PubMed:15019989, ECO:0000269|PubMed:15120075, ECO:0000269|PubMed:15155890, ECO:0000269|PubMed:16741748}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004515686.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004515686.1 | 1e-143 | BEL1-like homeodomain protein 9 isoform X1 | ||||
Refseq | XP_012567363.1 | 1e-143 | BEL1-like homeodomain protein 9 isoform X1 | ||||
Refseq | XP_027186728.1 | 1e-143 | BEL1-like homeodomain protein 9 isoform X1 | ||||
Refseq | XP_027186729.1 | 1e-143 | BEL1-like homeodomain protein 9 isoform X1 | ||||
Swissprot | Q9LZM8 | 3e-37 | BLH9_ARATH; BEL1-like homeodomain protein 9 | ||||
TrEMBL | A0A1S3DVW3 | 1e-142 | A0A1S3DVW3_CICAR; BEL1-like homeodomain protein 9 isoform X1 | ||||
STRING | XP_004515686.1 | 1e-143 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2810 | 33 | 73 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02030.1 | 1e-39 | TALE family protein |