![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004506104.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 219aa MW: 24452.8 Da PI: 8.1575 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 249.3 | 7e-77 | 17 | 183 | 3 | 170 |
YABBY 3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvs 97 s s+q+Cyv+CnfC+t+lavsvP tslfk+vtvrCGhCt+llsvn++ a + hl++s+ +++ ++ +++ + +++++ + ++ XP_004506104.1 17 QLSPSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPSANQLHLGHSFFNPQNLLEEIRNSPSTNMMMNQLPNPNDLV 111 56889****************************************99999999999999999999877444444444444444555555555555 PP YABBY 98 seklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 ++++ + ee+p++pp++rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl XP_004506104.1 112 MNTM-RGGPEEIPKPPPANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 183 5554.677899************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.6E-72 | 20 | 183 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 7.07E-8 | 128 | 177 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 1.9E-4 | 132 | 175 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0010158 | Biological Process | abaxial cell fate specification | ||||
GO:0010159 | Biological Process | specification of organ position | ||||
GO:0010450 | Biological Process | inflorescence meristem growth | ||||
GO:1902183 | Biological Process | regulation of shoot apical meristem development | ||||
GO:2000024 | Biological Process | regulation of leaf development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MSSSSSSTSF SPDQQQQLSP SDQLCYVHCN FCDTVLAVSV PCTSLFKTVT VRCGHCTNLL 60 SVNMRGLLLP SANQLHLGHS FFNPQNLLEE IRNSPSTNMM MNQLPNPNDL VMNTMRGGPE 120 EIPKPPPANR PPEKRQRVPS AYNRFIKDEI QRIKAGNPDI SHREAFSAAA KNWAHFPHIH 180 FGLMPDHQPV KKANVRQESE DVLIKDGFFT QANVGVSPY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00620 | PBM | Transfer from AT2G45190 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004506104.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT098301 | 0.0 | BT098301.1 Soybean clone JCVI-FLGm-12E18 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004506104.1 | 1e-164 | axial regulator YABBY 1 | ||||
Swissprot | O22152 | 1e-95 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | A0A1S2YKC7 | 1e-162 | A0A1S2YKC7_CICAR; axial regulator YABBY 1 | ||||
STRING | XP_004506104.1 | 1e-163 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2040 | 34 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 7e-83 | YABBY family protein |