PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

bZIP

Protein Properties

Length: 160aa MW: 18270.3 Da PI: 5.7736

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_004504310.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	45	2.4e-14	36	94	4	62
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 k+ +r+q+NRe+ArrsR +K++ +e L + ++ L++eN + ++ ++++ +++ e XP_004504310.1 36 QKKRKRMQSNRESARRSRMKKQQHMEDLNNQIEYLKKENNQISRNVGVTTQMYLNVEGE 94 6999*************************************999999999988877666 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.4E-16	33	97	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.9E-11	34	81	No hit	No description
PROSITE profile	PS50217	10.783	35	81	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	6.88E-12	37	89	No hit	No description
Pfam	PF00170	9.5E-11	37	87	IPR004827	Basic-leucine zipper domain
CDD	cd14702	2.78E-19	38	88	No hit	No description
PROSITE pattern	PS00036	0	40	55	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MASPGGAYSS GTSSLQNSGS GSEGDIQQQQ VHVMDQKKRK RMQSNRESAR RSRMKKQQHM 60 EDLNNQIEYL KKENNQISRN VGVTTQMYLN VEGENAILRV QMAELSNRLQ SLNDIINYIE 120 SSNSLFQETD QLFNDCGFFD TWNSFPVNQP IMASADMLMY

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269\|PubMed:23461773}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_004504310.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004504309.2	1e-116	bZIP transcription factor 44-like
Swissprot	C0Z2L5	1e-44	BZP44_ARATH; bZIP transcription factor 44
TrEMBL	A0A1S2YG52	1e-115	A0A1S2YG52_CICAR; bZIP transcription factor 44-like
STRING	XP_004504310.1	1e-116	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF613	34	147

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75390.1	3e-43	basic leucine-zipper 44

Publications ? help Back to Top
Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]