PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

WRKY

Protein Properties

Length: 162aa MW: 18644.4 Da PI: 4.7798

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_004501445.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	98.1	5.7e-31	101	159	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YYrC+ gC+vkk+ver+ +dp++v++tY g+H+h+ XP_004501445.1 101 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVDGCQVKKRVERDVNDPSYVITTYVGTHTHP 159 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	6.4E-33	88	159	IPR003657	WRKY domain
SuperFamily	SSF118290	2.35E-28	94	159	IPR003657	WRKY domain
PROSITE profile	PS50811	28.621	96	161	IPR003657	WRKY domain
SMART	SM00774	1.2E-34	101	160	IPR003657	WRKY domain
Pfam	PF03106	1.2E-24	102	159	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 162 aa Download sequence Send to blast
MTDKNPRPPN SLDSNFTNQP LELPEYFKFD DDQWPDDEPE PFVFEHVVNQ ENQQANKFVG 60 DFGGSGSYLE GSSSNDVSSE REKKEVTDKV AFKTQSEVEI LDDGFKWRKY GKKMVKNSPN 120 PRNYYRCSVD GCQVKKRVER DVNDPSYVIT TYVGTHTHPG FC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-24	91	158	7	74	Probable WRKY transcription factor 4
2lex_A	4e-24	91	158	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	Transfer from AT5G26170	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_004501445.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CT967316	2e-45	CT967316.8 M.truncatula DNA sequence from clone MTH2-189G21 on chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004501445.2	1e-116	probable WRKY transcription factor 50 isoform X1
Swissprot	Q8VWQ5	1e-38	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A1S2Y9A5	1e-114	A0A1S2Y9A5_CICAR; probable WRKY transcription factor 50 isoform X1
STRING	XP_004501445.1	1e-117	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1120	34	110

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	1e-40	WRKY DNA-binding protein 50

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]