PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004496797.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 233aa MW: 26436.2 Da PI: 9.6705 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 72.2 | 4.5e-23 | 16 | 64 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ +n+sn qvtfskRr g++KKA+EL++LC+aev +i+fs+ k++ + XP_004496797.1 16 KKMSNESNLQVTFSKRRSGLFKKASELCTLCGAEVVLIVFSPGEKVFSF 64 5689***************************************999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.8E-34 | 8 | 67 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 25.231 | 8 | 68 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.57E-35 | 9 | 77 | No hit | No description |
SuperFamily | SSF55455 | 1.96E-28 | 9 | 84 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-20 | 10 | 30 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.1E-24 | 18 | 64 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-20 | 30 | 45 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-20 | 45 | 66 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MSTEKKGRGR QKIEIKKMSN ESNLQVTFSK RRSGLFKKAS ELCTLCGAEV VLIVFSPGEK 60 VFSFGHPNVD TVINRYLSRV PLQHNGTMQF IEAHRNANVR ELNEALTQAN NQLDTEKKHG 120 DELSHLRKTT EAQFWWACPI DVMSKAQLEV FKKALEELKK LVAQHADMIV IQGAPTQTLP 180 IFVGNASTSN NAIHPHQRQV QMYPSQYFQN PMMQPHWFGF NNTGGGYGPT EFF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3kov_B | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3kov_I | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3kov_J | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_A | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_B | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_C | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_D | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_I | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_J | 8e-16 | 9 | 76 | 1 | 68 | Myocyte-specific enhancer factor 2A |
5f28_A | 9e-16 | 9 | 112 | 2 | 94 | MEF2C |
5f28_B | 9e-16 | 9 | 112 | 2 | 94 | MEF2C |
5f28_C | 9e-16 | 9 | 112 | 2 | 94 | MEF2C |
5f28_D | 9e-16 | 9 | 112 | 2 | 94 | MEF2C |
6byy_A | 9e-16 | 9 | 76 | 2 | 69 | MEF2 CHIMERA |
6byy_B | 9e-16 | 9 | 76 | 2 | 69 | MEF2 CHIMERA |
6byy_C | 9e-16 | 9 | 76 | 2 | 69 | MEF2 CHIMERA |
6byy_D | 9e-16 | 9 | 76 | 2 | 69 | MEF2 CHIMERA |
6bz1_A | 1e-15 | 9 | 76 | 2 | 69 | MEF2 CHIMERA |
6bz1_B | 1e-15 | 9 | 76 | 2 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004496797.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004496797.1 | 1e-177 | agamous-like MADS-box protein AGL62 | ||||
Swissprot | Q9FKK2 | 3e-63 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A1S2Y107 | 1e-176 | A0A1S2Y107_CICAR; agamous-like MADS-box protein AGL62 | ||||
STRING | XP_004496797.1 | 1e-176 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF128 | 33 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 3e-57 | AGAMOUS-like 62 |
Publications ? help Back to Top | |||
---|---|---|---|
|