![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004493958.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 84aa MW: 9297 Da PI: 10.5725 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 130.6 | 4.3e-41 | 19 | 84 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++ ++G+nPGlivllvvgglll+fl+gny+ly+yaqk++PPrkkkP+skkk+k+e+l+qGv++PGe XP_004493958.1 19 NAGSQGFNPGLIVLLVVGGLLLTFLIGNYALYMYAQKTIPPRKKKPISKKKMKKERLRQGVSAPGE 84 56789************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 5.7E-40 | 21 | 84 | IPR006779 | DNA binding protein S1FA |
ProDom | PD019013 | 7.0E-4 | 22 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MADDFEFADK VPPSFDRVNA GSQGFNPGLI VLLVVGGLLL TFLIGNYALY MYAQKTIPPR 60 KKKPISKKKM KKERLRQGVS APGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004493958.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004493958.1 | 5e-55 | DNA-binding protein S1FA-like | ||||
Swissprot | P42553 | 6e-15 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
Swissprot | Q7XLX6 | 9e-15 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A1S2XSP9 | 1e-53 | A0A1S2XSP9_CICAR; DNA-binding protein S1FA-like | ||||
STRING | XP_004493958.1 | 2e-54 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |
Publications ? help Back to Top | |||
---|---|---|---|
|