PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004486453.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 183aa MW: 20258.7 Da PI: 9.6373 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 103 | 2.8e-32 | 88 | 144 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+ekk+ +++rkpylheSRh hAl+R+Rg+gGrF XP_004486453.1 88 EEPVFVNAKQYHGILRRRQSRAKAESEKKV-ARNRKPYLHESRHLHALKRARGCGGRF 144 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.4E-36 | 86 | 147 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.645 | 87 | 147 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.3E-27 | 89 | 144 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.7E-23 | 90 | 112 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 92 | 112 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.7E-23 | 121 | 144 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MQPISANGIS HAGIDTQIVQ YAAHPPLGTG HAMVPPAYPY PDPYYRSIFA PYDAQPYPPQ 60 PYGGHPMANL QLMGIQHAGV PLPTDAVEEP VFVNAKQYHG ILRRRQSRAK AESEKKVARN 120 RKPYLHESRH LHALKRARGC GGRFLNSKKN ENQQDEVASA DNSQSNINLN SDRNDLAPSD 180 KTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 4e-21 | 87 | 152 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004486453.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT146024 | 0.0 | BT146024.1 Medicago truncatula clone JCVI-FLMt-11O7 unknown mRNA. | |||
GenBank | JQ918271 | 0.0 | JQ918271.1 Medicago truncatula nuclear transcription factor Y subunit A6 (NF-YA6) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004486451.1 | 1e-134 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_004486452.1 | 1e-134 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Swissprot | Q84JP1 | 1e-61 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A1S2XAR6 | 1e-133 | A0A1S2XAR6_CICAR; nuclear transcription factor Y subunit A-7 isoform X1 | ||||
STRING | XP_004486451.1 | 1e-134 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 4e-48 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|