PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

SBP

Protein Properties

Length: 142aa MW: 16263.8 Da PI: 7.8015

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00028671-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	135	2.4e-42	57	134	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cq+e+C+ad++eak yhrrhkvCe+h+kapvv v+gl++rfCqqCsrfh lsefDe+k+sCr+rLa+hnerrrk+++ WALNUT_00028671-RA 57 TCQAENCNADFTEAKPYHRRHKVCEFHAKAPVVNVDGLHKRFCQQCSRFHLLSEFDENKKSCRKRLAGHNERRRKSST 134 6**************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	2.6E-54	1	142	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	1.4E-33	50	119	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.787	55	132	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	5.76E-40	56	137	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	8.4E-32	58	131	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
METSRAEGKR SCKYYNNTVE EPEEEEDEAS EDEKKREMTP ASSRRTSSGS GGSTLITCQA 60 ENCNADFTEA KPYHRRHKVC EFHAKAPVVN VDGLHKRFCQ QCSRFHLLSE FDENKKSCRK 120 RLAGHNERRR KSSTDSYGEG SH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	9e-36	50	131	3	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018858093.1	1e-101	PREDICTED: squamosa promoter-binding protein 1
Swissprot	Q38741	6e-52	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A2I4HPL8	1e-100	A0A2I4HPL8_JUGRE; Squamosa promoter-binding-like protein
STRING	XP_006467766.1	6e-50	(Citrus sinensis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	1e-42	squamosa promoter binding protein-like 3

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]