 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
WALNUT_00025719-RA |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
Family |
WRKY |
Protein Properties |
Length: 121aa MW: 13818.6 Da PI: 10.0318 |
Description |
WRKY family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
WALNUT_00025719-RA | genome | JHU | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | WRKY | 98.1 | 5.5e-31 | 32 | 90 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+dDg++WrKYG+K+vk+s++pr+YY+C+s gC+vkk+ver++ed ++v++tYeg Hnhe
WALNUT_00025719-RA 32 MDDGFKWRKYGKKSVKNSPNPRNYYKCSSGGCEVKKRVERDREDASYVITTYEGVHNHE 90
69********************************************************8 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway |
GO:0042742 | Biological Process | defense response to bacterium |
GO:0050832 | Biological Process | defense response to fungus |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |