 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
WALNUT_00023050-RA |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
| Family |
M-type_MADS |
| Protein Properties |
Length: 102aa MW: 11705 Da PI: 10.3498 |
| Description |
M-type_MADS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| WALNUT_00023050-RA | genome | JHU | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 88.2 | 4.4e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krie+k+ rqvtfskR+ g++KKA EL vLCd+eva++ifs +g+lye+ss
WALNUT_00023050-RA 9 KRIEDKTSRQVTFSKRKGGLMKKARELAVLCDVEVALMIFSDRGRLYEFSS 59
79***********************************************96 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1tqe_P | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 8e-20 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | MADS-box transcription factor that acts redundantly with EJ2 to control meristem maturation and inflorescence architecture. {ECO:0000269|PubMed:28528644}. |
| UniProt | Probable transcription factor. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | JQ829074 | 3e-96 | JQ829074.1 Carya cathayensis flowering locus C-like protein 1 mRNA, complete cds. |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Dreni L, et al.
The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice.
Plant J., 2007. 52(4): p. 690-9
[PMID:17877710] - Tomato Genome Consortium
The tomato genome sequence provides insights into fleshy fruit evolution.
Nature, 2012. 485(7400): p. 635-41
[PMID:22660326] - Soyk S, et al.
Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene.
Cell, 2017. 169(6): p. 1142-1155.e12
[PMID:28528644]
|
